NEK3 anticorps

N° du produit ABIN634077

Cet anticorps anti-NEK3 est un anticorps Lapin Polyclonal détectant NEK3 dans WB. Adapté pour Humain.

Aperçu rapide pour NEK3 anticorps (ABIN634077)

Antigène: NEK3 (NIMA related kinase 3 (NEK3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEK3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NEK3 anticorps

Purification: Affinity purified

Immunogène: NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEK3 Blocking Peptide, (ABIN938485), is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEK3

Antigène: NEK3 (NIMA related kinase 3 (NEK3))

Autre désignation: NEK3

Sujet: NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.

Poids moléculaire: 58 kDa (MW of target protein)